Protein Info for BNILDI_03070 in Escherichia coli ECRC62

Name: nikA
Annotation: nickel ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02294: nickel ABC transporter, nickel/metallophore periplasmic binding protein" amino acids 22 to 520 (499 residues), 840.1 bits, see alignment E=2.7e-257 PF00496: SBP_bac_5" amino acids 68 to 437 (370 residues), 333 bits, see alignment E=1.2e-103

Best Hits

Swiss-Prot: 100% identical to NIKA_ECOLI: Nickel-binding periplasmic protein (nikA) from Escherichia coli (strain K12)

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 100% identity to eco:b3476)

MetaCyc: 100% identical to nickel ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Nickel ABC transporter, periplasmic nickel-binding protein NikA (TC 3.A.1.5.3)" in subsystem Transport of Nickel and Cobalt (TC 3.A.1.5.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (524 amino acids)

>BNILDI_03070 nickel ABC transporter substrate-binding protein (Escherichia coli ECRC62)
MLSTLRRTLFALLACASFIVHAAAPDEITTAWPVNVGPLNPHLYTPNQMFAQSMVYEPLV
KYQADGSVIPWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENFRAVLDNRQRH
AWLELANQIVDVKALSKTELQITLKSAYYPFLQELALPRPFRFIAPSQFKNHETMNGIKA
PIGTGPWILQESKLNQYDVFVRNENYWGEKPAIKKITFNVIPDPTTRAVAFETGDIDLLY
GNEGLLPLDTFARFSQNPAYHTQLSQPIETVMLALNTAKAPTNELAVREALNYAVNKKSL
IDNALYGTQQVADTLFAPSVPYANLGLKPRQYDPQKAKELLEKAGWTLPAGKDIREKNGQ
PLRIELSFIGTDALSKSMAEIIQADMRQIGADVSLIGEEESSIYARQRDGRFGMIFHRTW
GAPYDPHAFLSSMRVPSHADFQAQQGLADKPLIDKEIGEVLATHDETQRQALYRDILTRL
HDEAVYLPISYISMMVVSKPELGNIPYAPIATEIPFEQIKPVKP