Protein Info for BNILDI_03055 in Escherichia coli ECRC62

Name: yhhS
Annotation: Uncharacterized MFS-type transporter YhhS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 123 to 147 (25 residues), see Phobius details amino acids 150 to 154 (5 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 234 to 258 (25 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details PF07690: MFS_1" amino acids 39 to 365 (327 residues), 92.6 bits, see alignment E=1.2e-30 amino acids 270 to 414 (145 residues), 46.4 bits, see alignment E=1.4e-16

Best Hits

Swiss-Prot: 100% identical to YHHS_SHIFL: Uncharacterized MFS-type transporter YhhS (yhhS) from Shigella flexneri

KEGG orthology group: None (inferred from 99% identity to ecf:ECH74115_4793)

Predicted SEED Role

"Transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>BNILDI_03055 Uncharacterized MFS-type transporter YhhS (Escherichia coli ECRC62)
MVKMKHCCKNVVILMPEPVAEPALNGLRLNLRIVSIVMFNFASYLTIGLPLAVLPGYVHD
VMGFSAFWAGLVISLQYFATLLSRPHAGRYADLLGPKKIVVFGLCGCFLSGLGYLTAGLT
ASLPVISLLLLCLGRVILGIGQSFAGTGSTLWGVGVVGSLHIGRVISWNGIVTYGAMAMG
APLGVVFYHWGGLQALALIIMGVALVAILLAIPRPTVKASKGKPLPFRAVLGSVWLYGMA
LALASAGFGVIATFITLFYDAKGWDGAAFALTLFSCAFVGTRLLFPNGINRIGGLNVAMI
CFSVEIIGLLLVGVATMPWMAKIGVLLAGAGFSLVFPALGVVAVKAVPQQNQGAALATYT
VFMDLSLGVTGPLAGLVMSWAGVPVIYLAAAGLVAIALLLTWRLKKRPPEHVPEAASSS