Protein Info for BNILDI_03045 in Escherichia coli ECRC62

Name: yhhQ
Annotation: 7-cyano-7-deazaguanine/7-aminomethyl-7-deazaguani ne transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details TIGR00697: conserved hypothetical integral membrane protein" amino acids 12 to 205 (194 residues), 231.2 bits, see alignment E=5.2e-73 PF02592: Vut_1" amino acids 43 to 198 (156 residues), 127.1 bits, see alignment E=4e-41

Best Hits

Swiss-Prot: 100% identical to QPTR_ECOLI: Queuosine precursor transporter (yhhQ) from Escherichia coli (strain K12)

KEGG orthology group: K09125, hypothetical protein (inferred from 100% identity to ecw:EcE24377A_3953)

MetaCyc: 100% identical to queuosine precursor transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-412

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>BNILDI_03045 7-cyano-7-deazaguanine/7-aminomethyl-7-deazaguani ne transporter (Escherichia coli ECRC62)
MNVFSQTQRYKALFWLSLFHLLVITSSNYLVQLPVSIFGFHTTWGAFSFPFIFLATDLTV
RIFGAPLARRIIFAVMIPALLISYVISSLFYMGSWQGFGALAHFNLFVARIATASFMAYA
LGQILDVHVFNRLRQSRRWWLAPTASTLFGNVSDTLAFFFIAFWRSPDAFMAEHWMEIAL
VDYCFKVLISIVFFLPMYGVLLNMLLKRLADKSEINALQAS