Protein Info for BNILDI_02895 in Escherichia coli ECRC62

Name: yhhZ
Annotation: Uncharacterized protein YhhZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 TIGR03344: type VI secretion system effector, Hcp1 family" amino acids 1 to 147 (147 residues), 116.9 bits, see alignment E=4.4e-38 PF05638: T6SS_HCP" amino acids 26 to 139 (114 residues), 44.4 bits, see alignment E=1e-15

Best Hits

Swiss-Prot: 100% identical to YHHZ_ECOLI: Uncharacterized protein YhhZ (yhhZ) from Escherichia coli (strain K12)

KEGG orthology group: K06887, (no description) (inferred from 100% identity to eco:b3442)

Predicted SEED Role

"hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>BNILDI_02895 Uncharacterized protein YhhZ (Escherichia coli ECRC62)
MSNIVYLTVTGEQQGSISAGCGTSESTGNRWQSGHEDEIFTFSLLNNINNTGLGSQFHGI
TFCKLIDKSTPLFINSINNNEQLFMGFDFYRINRFGRWEKYYYIQLRGAFLSAIHHQIIE
NQLDTETITISYEFILCQHLIANTEFSYLALPENYNRLFLPNSKNQTNNRFKTLNSKAIG
RLLAAGGVYNGNIEGFRDTAEKLGGDAIKGYDQILNEKTAGIAIATASILLTKRSNVDTY
TEINSYLGKLRGQQKLLDGIEIIEIIYIKRPSKDLANLRKEFNKTVRKNFLIKLAKTSEA
SGRFNAEDLLRMRKGNVPLNYNVHHKLSLDDGGTNDFENLVLIENEPYHKVFTNMQSRIA
KGILVGESKITPWAIPSGSIYPPMKNIMDHTK