Protein Info for BNILDI_02875 in Escherichia coli ECRC62

Name: yhhW
Annotation: quercetin 2,3-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02678: Pirin
  • amino acids 7 to 119 (113 residues), 130 bits, E=5.5e-42
• PF07883: Cupin_2
  • amino acids 48 to 114 (67 residues), 27.3 bits, E=3.5e-10
• PF17954: Pirin_C_2
  • amino acids 143 to 228 (86 residues), 104.1 bits, E=5.4e-34

Best Hits

Swiss-Prot: 100% identical to YHHW_ECOLI: Quercetin 2,3-dioxygenase (yhhW) from Escherichia coli (strain K12)

KEGG orthology group: K06911, (no description) (inferred from 100% identity to eco:b3439)

MetaCyc: 100% identical to quercetin 2,3-dioxygenase (Escherichia coli K-12 substr. MG1655)
Quercetin 2,3-dioxygenase. [EC: 1.13.11.24]

Predicted SEED Role

"Qercetin 2,3-dioxygenase"

MetaCyc Pathways

• rutin degradation (1/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.24

Protein Sequence (231 amino acids)

>BNILDI_02875 quercetin 2,3-dioxygenase (Escherichia coli ECRC62)
MIYLRKANERGHANHGWLDSWHTFSFANYYDPNFMGFSALRVINDDVIEAGQGFGTHPHK
DMEILTYVLEGTVEHQDSMGNKEQVPAGEFQIMSAGTGIRHSEYNPSSTERLHLYQIWIM
PEENGITPRYEQRRFDAVQGKQLVLSPDARDGSLKVHQDMELYRWALLKDEQSVHQIAAE
RRVWIQVVKGNVTINGVKASTSDGLAIWDEQAISIHADSDSEVLLFDLPPV