Protein Info for BNILDI_02585 in Escherichia coli ECRC62

Name: yhfZ
Annotation: Uncharacterized protein YhfZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF14502: HTH_41" amino acids 24 to 71 (48 residues), 66.5 bits, see alignment 1.1e-22 PF14503: YhfZ_C" amino acids 75 to 301 (227 residues), 281.8 bits, see alignment E=4.2e-88

Best Hits

Swiss-Prot: 98% identical to YHFZ_ECOLI: Uncharacterized protein YhfZ (yhfZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b3383)

Predicted SEED Role

"Hypothetical protein YhfZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>BNILDI_02585 Uncharacterized protein YhfZ (Escherichia coli ECRC62)
MRRTFIKKEGVVITTLARYLLGEKCGNRLKTIDELATECRSSVGLTQAALKTLESSGAIR
IERRGRNGSYLVEMDNKALLSHVDINNVVCAMPLPYTRLYEGLASGLKAQFDGIPFYYAH
MRGADIRVECLLNGVYDMAVVSRLAAESYLTQKGFCLALELGPHTYVGEHQLICRKGESA
NVKRVGLDNRSADQKIMTDVFFGDSDVERVDLSYHESLQRIVKGDVDAVIWNVVAENELT
MLGLEATPLTDDPRFLQATEAVVLTRADDYPMQQLLRAVVDKHALLAHQQRVVSGEQEPS
Y