Protein Info for BNILDI_02485 in Escherichia coli ECRC62

Name: yhfK
Annotation: Uncharacterized protein YhfK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 696 transmembrane" amino acids 13 to 31 (19 residues), see Phobius details amino acids 36 to 52 (17 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 367 to 384 (18 residues), see Phobius details amino acids 390 to 406 (17 residues), see Phobius details amino acids 411 to 431 (21 residues), see Phobius details amino acids 436 to 453 (18 residues), see Phobius details amino acids 458 to 477 (20 residues), see Phobius details amino acids 483 to 505 (23 residues), see Phobius details TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 12 to 675 (664 residues), 924.2 bits, see alignment E=2.3e-282 PF12805: FUSC-like" amino acids 63 to 330 (268 residues), 242.6 bits, see alignment E=4.5e-76 PF13515: FUSC_2" amino acids 377 to 498 (122 residues), 77.4 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 100% identical to YHFK_ECOLI: Uncharacterized protein YhfK (yhfK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3358)

Predicted SEED Role

"FIG00638035: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (696 amino acids)

>BNILDI_02485 Uncharacterized protein YhfK (Escherichia coli ECRC62)
MWRRLIYHPDINYALRQTLVLCLPVAVGLMLGELRFGLLFSLVPACCNIAGLDTPHKRFF
KRLIIGASLFATCSLLTQLLLVKDVPLPFLLTGLTLVLGVTAELGPLHAKLLPASLLAAI
FTLSLAGYMPVWEPLLIYALGTLWYGLFNWFWFWIWREQPLRESLSLLYRELADYCEAKY
SLLTQHTDPEKALPPLLVRQQKAVDLITQCYQQMHMLSAQNNTDYKRMLRIFQEALDLQE
HISVSLHQPEEVQKLVERSHAEEVIRWNAQTVAARLRVLADDILYHRLPTRFTMEKQIGA
LEKIARQHPDNPVGQFCYWHFSRIARVLRTQKPLYARDLLADKQRRMPLLPALKSYLSLK
SPALRNAGRLSVMLSVASLMGTALHLPKSYWILMTVLLVTQNGYGATRLRIVNRSVGTVV
GLIIAGVALHFKIPEGYTLTLMLITTLASYLILRKNYGWATVGFTITAVYTLQLLWLNGE
QYILPRLIDTIIGCLIAFGGTVWLWPQWQSGLLRKNAHDALEAYQEAIRLILSEDPQPTP
LAWQRMRVNQAHNTLYNSLNQAMQEPAFNSHYLADMKLWVTHSQFIVEHINAMTTLAREH
RALPPELAQEYLQSCEIAIQRCQQRLEYDEPGSSGDANIMDAPEMQPHEGAAGTLEQHLQ
RVIGHLNTMHTISSMAWRQRPHHGIWLSRKLRDSKA