Protein Info for BNILDI_02370 in Escherichia coli ECRC62

Annotation: prepilin peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01478: Peptidase_A24
  • amino acids 10 to 117 (108 residues), 80.8 bits, E=4.8e-27

Best Hits

Swiss-Prot: 99% identical to HOPD_ECOLX: Leader peptidase HopD (hopD) from Escherichia coli

KEGG orthology group: K02506, leader peptidase HopD [EC: 3.4.23.43] (inferred from 100% identity to eoi:ECO111_4143)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Protein Sequence (155 amino acids)

>BNILDI_02370 prepilin peptidase (Escherichia coli ECRC62)
MDANLPFLILYACLSVLLFLWDAKHGLLPDRFTCPLLWSGLLFSQVCNPDGLADALWGAI
IGYGTFAVIYWGYRILRHKEGLGYGDVKFLAALGAWHTWTFLPRLVFLAASFACGAVVVG
LLMRGKESLKNPLPFGPFLAAAGFVVGWDSLLAGR