Protein Info for BNILDI_02025 in Escherichia coli ECRC62

Name: accB
Annotation: acetyl-CoA carboxylase biotin carboxyl carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 TIGR00531: acetyl-CoA carboxylase, biotin carboxyl carrier protein" amino acids 1 to 156 (156 residues), 241.3 bits, see alignment E=3e-76 PF00364: Biotin_lipoyl" amino acids 83 to 155 (73 residues), 87.6 bits, see alignment E=3.9e-29

Best Hits

Swiss-Prot: 100% identical to BCCP_ECOL6: Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 100% identity to eco:b3255)

MetaCyc: 100% identical to biotin carboxyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>BNILDI_02025 acetyl-CoA carboxylase biotin carboxyl carrier protein (Escherichia coli ECRC62)
MDIRKIKKLIELVEESGISELEISEGEESVRISRAAPAASFPVMQQAYAAPMMQQPAQSN
AAAPATVPSMEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEA
MKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE