Protein Info for BNILDI_01610 in Escherichia coli ECRC62

Name: truB
Annotation: tRNA pseudouridine(55) synthase TruB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 11 to 219 (209 residues), 317.6 bits, see alignment E=1.8e-99 PF01509: TruB_N" amino acids 33 to 180 (148 residues), 193.2 bits, see alignment E=5e-61 PF16198: TruB_C_2" amino acids 181 to 246 (66 residues), 68 bits, see alignment E=9.9e-23 PF09157: TruB-C_2" amino acids 252 to 309 (58 residues), 70.8 bits, see alignment E=1.1e-23

Best Hits

Swiss-Prot: 100% identical to TRUB_ECO24: tRNA pseudouridine synthase B (truB) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 100% identity to eco:b3166)

MetaCyc: 100% identical to tRNA pseudouridine55 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11839 [EC: 5.4.99.25]

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12 or 5.4.99.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>BNILDI_01610 tRNA pseudouridine(55) synthase TruB (Escherichia coli ECRC62)
MSRPRRRGRDINGVLLLDKSQGMSSNDALQKVKRIYNANRAGHTGALDPLATGMLPICLG
EATKFSQYLLDSDKRYRVIARLGQRTDTSDADGQIVEERPVTFSAEQLAAALDTFRGDIE
QIPSMYSALKYQGKKLYEYARQGIEVPREARPITVYELLFIRHEGNELELEIHCSKGTYI
RTIIDDLGEKLGCGAHVIYLRRLAVSKYPVERMVTLEHLRELVEQAEQQDIPAAELLDPL
LMPMDSPASDYPVVNLPLTSSVYFKNGNPVRTSGAPLEGLVRVTEGENGKFIGMGEIDDE
GRVAPRRLVVEYPA