Protein Info for BNILDI_01565 in Escherichia coli ECRC62
Name: yhbW
Annotation: luciferase-like monooxygenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to YHBW_ECOL6: Luciferase-like monooxygenase (yhbW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: None (inferred from 100% identity to eco:b3160)Predicted SEED Role
"Luciferase-like monooxygenase (EC 1.14.-.-)" (EC 1.14.-.-)
KEGG Metabolic Maps
- 1,4-Dichlorobenzene degradation
- Ascorbate and aldarate metabolism
- Benzoxazinone biosynthesis
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of steroids
- Biosynthesis of terpenoids and steroids
- Brassinosteroid biosynthesis
- Carotenoid biosynthesis - General
- Diterpenoid biosynthesis
- Limonene and pinene degradation
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Sphingolipid metabolism
- Tryptophan metabolism
- Ubiquinone and menaquinone biosynthesis
- gamma-Hexachlorocyclohexane degradation
Isozymes
Compare fitness of predicted isozymes for: 1.14.-.-
Use Curated BLAST to search for 1.14.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (335 amino acids)
>BNILDI_01565 luciferase-like monooxygenase (Escherichia coli ECRC62) MTDKTIAFSLLDLAPIPEGSSAREAFSHSLDLARLAEKRGYHRYWLAEHHNMTGIASAAT SVLIGYLAANTTTLHLGSGGVMLPNHSPLVIAEQFGTLNTLYPGRIDLGLGRAPGSDQRT MMALRRHMSGDIDNFPRDVAELVDWFDARDPNPHVRPVPGYGEKIPVWLLGSSLYSAQLA AQLGLPFAFASHFAPDMLFQALHLYRSNFKPSARLEKPYAMVCINIIAADSNRDAEFLFT SMQQAFVKLRRGETGQLPPPIQNMDQFWSPSEQYGVQQALSMSLVGDKAKVRHGLQSILR ETDADEIMVNGQIFDHQARLHSFELAMDVKEELLG