Protein Info for BNILDI_01445 in Escherichia coli ECRC62
Name: agaS
Annotation: aldose isomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to AGAS_ECOLI: Putative D-galactosamine-6-phosphate deaminase AgaS (agaS) from Escherichia coli (strain K12)
KEGG orthology group: K02082, tagatose-6-phosphate ketose/aldose isomerase [EC: 5.-.-.-] (inferred from 100% identity to eco:b3136)MetaCyc: 99% identical to D-galactosamine-6-phosphate deaminase/isomerase (Escherichia coli O157:H7)
3.5.99.-
Predicted SEED Role
"Galactosamine-6-phosphate isomerase (EC 5.3.1.-)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization (EC 5.3.1.-)
MetaCyc Pathways
- D-galactosamine and N-acetyl-D-galactosamine degradation (4/4 steps found)
- N-acetyl-D-galactosamine degradation (4/5 steps found)
KEGG Metabolic Maps
- Biosynthesis of ansamycins
- Biosynthesis of steroids
- Carotenoid biosynthesis - General
- Galactose metabolism
- Inositol phosphate metabolism
- Lipopolysaccharide biosynthesis
- Pentose and glucuronate interconversions
Isozymes
Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-
Use Curated BLAST to search for 5.-.-.- or 5.3.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (384 amino acids)
>BNILDI_01445 aldose isomerase (Escherichia coli ECRC62) MPENYTPAAAATGTWTEEEIRHQPRAWIRSLTNIDALRSALNNFLEPLLRKENLRIILTG AGTSAFIGDIIAPWLASHTGKNFSAVPTTDLVTNPMDYLNPAHPLLLISFGRSGNSPESV AAVELANQFVPECYHLPITCNEAGALYQNAINSDNAFALLMPAETHDRGFAMTSSITTMM ASCLAVFAPETINSQTFRDVADRCQAILTSLGDFSEGVFGYAPWKRIVYLGSGGLQGAAR ESALKVLELTAGKLAAFYDSPTGFRHGPKSLVDNETLVVVFVSSHPYTRQYDLDLLAELR RDNQAMRVIAIAAESTDIVAAGPHIILPPSRHFIDVEQAFCFLMYAQTFALMQSLHMGNT PDTPSASGTVNRVVQGVIIHPWQA