Protein Info for BNILDI_01405 in Escherichia coli ECRC62

Name: yhaV
Annotation: type II toxin-antitoxin system ribonuclease toxin YhaV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF11663: Toxin_YhaV" amino acids 12 to 150 (139 residues), 182.5 bits, see alignment E=2.1e-58

Best Hits

Swiss-Prot: 99% identical to YHAV_ECOL6: Toxin YhaV (yhaV) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 98% identity to eco:b3130)

MetaCyc: 98% identical to ribosome-dependent mRNA interferase toxin YhaV (Escherichia coli K-12 substr. MG1655)
Physarum polycephalum ribonuclease. [EC: 3.1.26.1]

Predicted SEED Role

"Uncharacterized protein yhaV"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>BNILDI_01405 type II toxin-antitoxin system ribonuclease toxin YhaV (Escherichia coli ECRC62)
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHI
TVNPSSPAFRHGKSLGSGKNKDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTY
GKKTDAYTVFSKMLKRGHPPADWESLTQETEENH