Protein Info for BNILDI_00965 in Escherichia coli ECRC62

Name: yqiJ
Annotation: Inner membrane protein YqiJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details PF21001: YqiJ_N" amino acids 8 to 115 (108 residues), 60.5 bits, see alignment E=1.8e-20 PF07290: YqiJ_OB" amino acids 139 to 198 (60 residues), 52 bits, see alignment E=6e-18

Best Hits

Swiss-Prot: 99% identical to YQIJ_ECOLI: Inner membrane protein YqiJ (yqiJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b3050)

Predicted SEED Role

"FIG00637968: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>BNILDI_00965 Inner membrane protein YqiJ (Escherichia coli ECRC62)
MILFADYNTPYLFAISFVLLIGLLEILALICGHMLSGALDAHLDHYDSITTGHISQALHY
LNIGRLPALVVLCLLAGFFGLIGILLQHACIMVWQSPLSNLFVVPVSLLFTIIAVHYTGK
IVAPWIPRDHSSAITEEEYIGSMALITGHQATSGNPCEGKLTDQFGQIHYLLLEPEEGKF
FTKGDKVLIICRLSATRYLAENNPWPQIL