Protein Info for BNILDI_00820 in Escherichia coli ECRC62

Name: ygiQ
Annotation: YgiQ family radical SAM protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 739 PF08497: Radical_SAM_N" amino acids 29 to 379 (351 residues), 465.3 bits, see alignment E=1.3e-143 TIGR03904: uncharacterized radical SAM protein YgiQ" amino acids 29 to 644 (616 residues), 883.3 bits, see alignment E=3.3e-270 PF04055: Radical_SAM" amino acids 380 to 585 (206 residues), 43.8 bits, see alignment E=4.7e-15 PF11842: DUF3362" amino acids 594 to 722 (129 residues), 139.8 bits, see alignment E=1.3e-44

Best Hits

Swiss-Prot: 100% identical to YGIQ_ECOLI: UPF0313 protein YgiQ (ygiQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecr:ECIAI1_3164)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (739 amino acids)

>BNILDI_00820 YgiQ family radical SAM protein (Escherichia coli ECRC62)
MSSISLIQPDRDLFSWPQYWAACFGPAPFLPMSREEMDQLGWDSCDIILVTGDAYVDHPS
FGMAICGRMLEAQGFRVGIIAQPDWSSKDDFMRLGKPNLFFGVTAGNMDSMINRYTADRR
LRHDDAYTPDNVAGKRPDRATLVYTQRCKEAWKDVPVILGGIEASLRRTAHYDYWSDTVR
RSVLVDSKADMLMFGNGERPLVEVAHRLAMGEPISEIRDVRNTAIIVKEALPGWSGVDST
RLDTPGKIDPIPHPYGEDLPCADNKPVAPKKQEAKAVTVQPPRPKPWEKTYVLLPSFEKV
KGDKVLYAHASRILHHETNPGCARALMQKHGDRYVWINPPAIPLSTEEMDSVFALPYKRV
PHPAYGNARIPAYEMIRFSVNIMRGCFGGCSFCSITEHEGRIIQSRSEDSIINEIEAIRD
TVPGFTGVISDLGGPTANMYMLRCKSPRAEQTCRRLSCVYPDICPHMDTNHEPTINLYRR
ARDLKGIKKILIASGVRYDIAVEDPRYIKELATHHVGGYLKIAPEHTEEGPLSKMMKPGM
GSYDRFKELFDTYSKQAGKEQYLIPYFISAHPGTRDEDMVNLALWLKKHRFRLDQVQNFY
PSPLANSTTMYYTGKNPLAKIGYKSEDVFVPKGDKQRRLHKALLRYHDPANWPLIRQALE
AMGKKHLIGSRRDCLVPAPTIEEMREARRQNRNTRPALTKHTPMATQRQTPATAKKASST
QSRPVNAGAKKRPKAAVGR