Protein Info for BNILDI_00735 in Escherichia coli ECRC62

Name: hybO
Annotation: hydrogenase 2 small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 334 to 355 (22 residues), see Phobius details TIGR00391: hydrogenase (NiFe) small subunit (hydA)" amino acids 2 to 365 (364 residues), 653.1 bits, see alignment E=1.3e-200 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 13 to 37 (25 residues), 24.5 bits, see alignment (E = 2.4e-09) PF01058: Oxidored_q6" amino acids 59 to 204 (146 residues), 101.5 bits, see alignment E=3.1e-33 PF14720: NiFe_hyd_SSU_C" amino acids 224 to 301 (78 residues), 90 bits, see alignment E=1e-29

Best Hits

Swiss-Prot: 100% identical to MBHT_ECOLI: Hydrogenase-2 small chain (hybO) from Escherichia coli (strain K12)

KEGG orthology group: K06282, hydrogenase small subunit [EC: 1.12.99.6] (inferred from 100% identity to eco:b2997)

MetaCyc: 100% identical to hydrogenase 2 small subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Uptake hydrogenase small subunit precursor (EC 1.12.99.6)" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase (EC 1.12.99.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.99.6

Use Curated BLAST to search for 1.12.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>BNILDI_00735 hydrogenase 2 small subunit (Escherichia coli ECRC62)
MTGDNTLIHSHGINRRDFMKLCAALAATMGLSSKAAAEMAESVTNPQRPPVIWIGAQECT
GCTESLLRATHPTVENLVLETISLEYHEVLSAAFGHQVEENKHNALEKYKGQYVLVVDGS
IPLKDNGIYCMVAGEPIVDHIRKAAEGAAAIIAIGSCSAWGGVAAAGVNPTGAVSLQEVL
PGKTVINIPGCPPNPHNFLATVAHIITYGKPPKLDDKNRPTFAYGRLIHEHCERRPHFDA
GRFAKEFGDEGHREGWCLYHLGCKGPETYGNCSTLQFCDVGGVWPVAIGHPCYGCNEEGI
GFHKGIHQLANVENQTPRSQKPDVNAKEGGNVSAGAIGLLGGVVGLVAGVSVMAVRELGR
QQKKDNADSRGE