Protein Info for BNILDI_00655 in Escherichia coli ECRC62

Name: yghQ
Annotation: Inner membrane protein YghQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 30 to 58 (29 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 177 to 208 (32 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 311 to 335 (25 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 384 to 431 (48 residues), see Phobius details PF01943: Polysacc_synt" amino acids 19 to 280 (262 residues), 32.1 bits, see alignment E=8.1e-12 PF13440: Polysacc_synt_3" amino acids 91 to 283 (193 residues), 29.8 bits, see alignment E=3.7e-11

Best Hits

KEGG orthology group: None (inferred from 98% identity to ecq:ECED1_3633)

Predicted SEED Role

"Inner membrane protein YghQ, probably involved in polysaccharide biosynthesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>BNILDI_00655 Inner membrane protein YghQ (Escherichia coli ECRC62)
LAGFNIKHWFADGAFRTIIRNSAWLGSSNVVSALLGLLALSCAGKGMTPAMFGVLVIVQS
YAKSISDFIKFQTWQLVVQYGTPALTNNNLQQFRNVVSFSFSLDIVSGAVAIVGGIALLP
FLSHSLGLDDQSFWLAALYCTLIPSLASSTPTGILRAVDRFDLIAVQQATKPFLRAAGSV
VAWYFDFGFAGFVIAWYVSNLVGGTMYWWFAARELRRRNIHNAFKLNLFESARHIKGAWS
FVWSTNIAHSIWSARNSCSTVLVGIVLGPAAAGLFKIAMTFFDAAGTPAGLLGKSFYPEV
MRLDPRTTRPWLLGVKSGLLAGGIGILVALAVFIVGKPLISLVFGVKYLEAYDLIQVMLG
AIVISMLGFPQESLLLMAGKQRAFLVAQTIASIGYIVLLFMFCHLFGVLGAAFAYFGGQC
LDVALSLIPTLKAFFQRHSLLYNAAGEKS