Protein Info for BNILDI_00635 in Escherichia coli ECRC62

Name: lptG
Annotation: LPS export ABC transporter permease LptG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 305 to 331 (27 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 4 to 354 (351 residues), 308.4 bits, see alignment E=2.3e-96 PF03739: LptF_LptG" amino acids 6 to 353 (348 residues), 240.3 bits, see alignment E=1.6e-75

Best Hits

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 99% identity to eoh:ECO103_3663)

Predicted SEED Role

"Permease Ygh-P2, YjgP/YjgQ family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>BNILDI_00635 LPS export ABC transporter permease LptG (Escherichia coli ECRC62)
MNVFSRYLIRHLFLGFAAAAGLLLPLFTTFNLINELDDVSPGGYRWTQAVLVVLMTLPRT
LVELSPFIALLGGIVGLGQLSKNSELTAIRSTGFSIFRIALVALVAGILWTVSLGAIDEW
VASPLQQQALQIKSTATALGEDDDITGNMLWVRRGNEFVTVKSLNEQGQPVGVEIFHYRD
DLSLESYIYARSATIKDDKTWILHGVNHKKWLNGKETLETSDNLAWQSAFTSMDLDELSM
PGNTFSVRQLNHYIHYLQETGQPSSEYRLALWEKLGQPILTLAMILLAVPFTFSAPRSPG
MGSRLAVGVIVGLLTWISYQIMVNLGLLFALSAPVTALGLPVAFVLVALSLVYWYDRQH