Protein Info for BACOVA_05602 in Bacteroides ovatus ATCC 8483

Annotation: hydrogenase, Fe-only

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 PF13510: Fer2_4" amino acids 4 to 84 (81 residues), 63.3 bits, see alignment E=6.1e-21 PF10588: NADH-G_4Fe-4S_3" amino acids 92 to 129 (38 residues), 58.4 bits, see alignment 1.4e-19 TIGR02512: [FeFe] hydrogenase, group A" amino acids 147 to 525 (379 residues), 555.3 bits, see alignment E=2.9e-171 PF12838: Fer4_7" amino acids 154 to 212 (59 residues), 30.1 bits, see alignment 1.9e-10 PF00037: Fer4" amino acids 195 to 214 (20 residues), 29.3 bits, see alignment (E = 1.9e-10) PF02906: Fe_hyd_lg_C" amino acids 231 to 521 (291 residues), 313.6 bits, see alignment E=3.8e-97 PF02256: Fe_hyd_SSU" amino acids 531 to 585 (55 residues), 84.5 bits, see alignment 1.5e-27

Best Hits

Swiss-Prot: 66% identical to HNDD_DESFR: NADP-reducing hydrogenase subunit HndD (hndD) from Desulfovibrio fructosivorans

KEGG orthology group: K00336, NADH dehydrogenase I subunit G [EC: 1.6.5.3] (inferred from 96% identity to bth:BT_0124)

Predicted SEED Role

"NADP-reducing [Fe]-hydrogenase, cytoplasmic, alpha subunit (EC 1.12.1.4)" (EC 1.12.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.12.1.4 or 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (588 amino acids)

>BACOVA_05602 hydrogenase, Fe-only (Bacteroides ovatus ATCC 8483)
MEEKQITLQIDGHFITVPEGSTILEAAIKIGINIPTLCHIDLKGTCIKNNPASCRICVVE
VMGRRNLAPACATRCTEGMVVKTSTLRVMNARKVVAELILSDHPNDCLTCPKCGNCELQT
LALRFNIREMPFNGGELSPRKREITASIVRNMDKCIFCRRCESVCNDVQTVGALGAIRRG
FNTTIAPAFDRMMTESECTYCGQCVAVCPVGALTERDYTNHLLDDLANPDKVVIVQTAPA
VRAALGEEFGFPPGTLVTGKMVYALRELGFDYVFDTDFAADLTIMEEGSEILNRLTRYLN
GDKSVRLPILTSCCPAWVNFFEHHFPDMLDIPSTARSPQQMFGSIAKSYWAEKMGIPREK
LVVVSIMPCLAKKYECARDEFKVNGIPDVDYSISTRELARLIKRANIGFPLVLDSPFDNP
MGESTGAGVIFGTTGGVMEAALRSVYEIYTGEPLKNVNFEQVRGLNGVRRATINLNGFEL
KVGIAHGLGNARHLLEDIRNGHNEYHVIEIMACPGGCIGGGGQPLHHGNSEILYARANAL
YREDANKPLRKSHENPYIKTLYEDYLGKPLGEKSETLLHTHYFNKAID