Protein Info for BACOVA_05549 in Bacteroides ovatus ATCC 8483

Annotation: Cof-like hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 TIGR00099: Cof-like hydrolase" amino acids 5 to 263 (259 residues), 169 bits, see alignment E=2.3e-53 TIGR01484: HAD hydrolase, family IIB" amino acids 5 to 237 (233 residues), 87.7 bits, see alignment E=1.8e-28 PF08282: Hydrolase_3" amino acids 6 to 263 (258 residues), 205.4 bits, see alignment E=2.6e-64 PF05116: S6PP" amino acids 180 to 244 (65 residues), 21 bits, see alignment E=4.6e-08 TIGR00369: uncharacterized domain 1" amino acids 290 to 403 (114 residues), 92.1 bits, see alignment E=3.9e-30 PF03061: 4HBT" amino acids 320 to 397 (78 residues), 61.4 bits, see alignment E=1.7e-20

Best Hits

KEGG orthology group: K07024, (no description) (inferred from 94% identity to bth:BT_4699)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>BACOVA_05549 Cof-like hydrolase (Bacteroides ovatus ATCC 8483)
MKYKLLVLDVDGTLLNDAKEISKRTLAALLKVQQMGVRIVLASGRPTYGLMPLAKMLELG
NYGGFILSYNGCQIINAQNGEILFERRINPEMLPYLEKKARKNGFALFTYHDDTIITDSP
ENEHIQNEARLNDLQIIKEEEFSAAVDFAPCKCMLVSDDEEALLGLEDHWKRRLNGALDV
FRSEPYFLEVVPCAIDKANSLGALLEVLGMKREEVIAVGDGVCDVTMIQLAGLGIAMGHS
QDSVKACADYVTASNEEDGVAVAVEKAIISEVRVAEIPLDQLNAQARHALMGNLGIQYTY
ADEDRVEATMPVDHRTRQPFGILHGGATLALAETVAGLGSMILCQPDEIVVGMQVSGNHI
SSAHEGDTVRAVGTVVHKGRSSHVWNVDVFTSTNKLVSSIRVVNSVMKKR