Protein Info for BACOVA_05372 in Bacteroides ovatus ATCC 8483

Annotation: protein CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 transmembrane" amino acids 5 to 22 (18 residues), see Phobius details amino acids 34 to 56 (23 residues), see Phobius details amino acids 68 to 84 (17 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details PF02537: CRCB" amino acids 6 to 118 (113 residues), 100.9 bits, see alignment E=2.4e-33 TIGR00494: protein CrcB" amino acids 7 to 118 (112 residues), 98.6 bits, see alignment E=1.5e-32

Best Hits

Swiss-Prot: 61% identical to CRCB_BACFN: Putative fluoride ion transporter CrcB (crcB) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K06199, CrcB protein (inferred from 61% identity to bhl:Bache_1670)

Predicted SEED Role

"Protein crcB homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>BACOVA_05372 protein CrcB (Bacteroides ovatus ATCC 8483)
MSKEVIYIFIGGGTGSALRYFIQLLMHERIVPYHFPWATFTVNLLGSFLIGLFYALSERF
HLPFEFRLFLTTGLCGGFTTFSTFSSDGVGLLKGEFYGAFVLYTLLSIGIGLAATLAGGY
VGKQI