Protein Info for BACOVA_05239 in Bacteroides ovatus ATCC 8483

Annotation: heterodisulfide reductase, C subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13183: Fer4_8
  • amino acids 19 to 83 (65 residues), 38.8 bits, E=1.7e-13
• PF13534: Fer4_17
  • amino acids 22 to 84 (63 residues), 28.6 bits, E=2.4e-10
• PF12838: Fer4_7
  • amino acids 22 to 82 (61 residues), 30 bits, E=8.7e-11

Best Hits

KEGG orthology group: K03390, heterodisulfide reductase subunit C [EC: 1.8.98.1] (inferred from 49% identity to aps:CFPG_238)

Predicted SEED Role

"CoB--CoM heterodisulfide reductase subunit C (EC 1.8.98.1)" in subsystem Anaerobic respiratory reductases or H2:CoM-S-S-HTP oxidoreductase or Methanogenesis (EC 1.8.98.1)

MetaCyc Pathways

• coenzyme B/coenzyme M regeneration I (methanophenazine-dependent) (1/4 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.8.98.1

Use Curated BLAST to search for 1.8.98.1

Protein Sequence (184 amino acids)

>BACOVA_05239 heterodisulfide reductase, C subunit (Bacteroides ovatus ATCC 8483)
MENKECISYDLEQKTGIDVSYCYQCGKCTAGCVLSEEMDYAPSYILRLLQTKNAQNDRRV
LSSNAIWICLNCENCIARCPKEINIPEVMDYLREKSRKEGCISKESRPVVAFHSAFLESV
KRTGRLYEVGLVAGFKARTLRLTQDLNVAPVMFVKGKLNLLPERVKDENKIKKIFAQTIE
KTQK