Protein Info for BACOVA_05200 in Bacteroides ovatus ATCC 8483

Annotation: CBS domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details PF01595: CNNM" amino acids 7 to 185 (179 residues), 126.1 bits, see alignment E=1.9e-40 PF00571: CBS" amino acids 215 to 266 (52 residues), 24 bits, see alignment 5.9e-09 amino acids 275 to 324 (50 residues), 30.6 bits, see alignment 5.1e-11 PF03471: CorC_HlyC" amino acids 340 to 416 (77 residues), 71.5 bits, see alignment E=7.2e-24

Best Hits

KEGG orthology group: None (inferred from 93% identity to bth:BT_4370)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>BACOVA_05200 CBS domain protein (Bacteroides ovatus ATCC 8483)
MNIYISLIITMVFSAFFSGVEIAFVSVDKLRFEMERKGGITSRILSIFFKNPNEFISTML
VGNNIALVIYGILMAQIIGDNLLAGFIDNHFLMVLAQTVISTLIILVTGEFLPKTIFKIN
PNLVLNVFAIPLIICYVILYPISKLASGLSCLFLRVFGMKINKDASDRAFGKVDLDYFVQ
SSIDNAENEEELDTEVKIFQNALDFSNIKIRDCIVPRTEVVAVDLTTSLDELKSRFIESG
ISKIIVYDGNIDNVVGYIHSSEMFRAPKNWHENVKQVPIVPETMSANKLMKLFMQQKKTI
AVVVDEFGGTSGIVSLEDLVEEIFGDIEDEHDNTSYISKQIDEREYVLSARLEIEKVNET
FGLDLPESDDYLTVGGLILNQYQSFPKLHEVVRVGRYQFKIIKVTATKIELVRLKVLE