Protein Info for BACOVA_05069 in Bacteroides ovatus ATCC 8483

Annotation: PhoH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF02562: PhoH" amino acids 104 to 307 (204 residues), 312.7 bits, see alignment E=2e-97 PF13604: AAA_30" amino acids 108 to 316 (209 residues), 38.7 bits, see alignment E=1.8e-13 PF13245: AAA_19" amino acids 112 to 260 (149 residues), 27.7 bits, see alignment E=5.3e-10

Best Hits

KEGG orthology group: K06217, phosphate starvation-inducible protein PhoH and related proteins (inferred from 100% identity to bth:BT_4218)

Predicted SEED Role

"Phosphate starvation-inducible protein PhoH, predicted ATPase" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>BACOVA_05069 PhoH family protein (Bacteroides ovatus ATCC 8483)
MIEKLIVLEDIDPVIFYGVNNANIQLIKALYPKLRIVARGNVIKVLGDEEEMCAFEENIT
KLEKYCAEYNSLKEEVIIDIIKGNAPQAEQTGNVIVFSVTGKPIIPRSENQLKLVEGFAK
NDMVFAIGPAGSGKTYTAIALAVRALKNKEIKKIILSRPAVEAGEKLGFLPGDMKDKIDP
YLQPLYDALQDMIPAAKLKEYMELNIIQIAPLAFMRGRTLNDAVVILDEAQNTTTQQIKM
FLTRMGMNTKMIVTGDMTQIDLPASQTSGLVQALRILKGVKGISFVELNKKDIVRHKLVE
RIVDAYEKFDKEAKAEREKRKNEQLVINGERPVKLAKD