Protein Info for BACOVA_04976 in Bacteroides ovatus ATCC 8483

Annotation: L-rhamnose 1-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05336: rhaM
  • amino acids 3 to 103 (101 residues), 108.3 bits, E=1.2e-35
• TIGR02625: L-rhamnose mutarotase
  • amino acids 3 to 104 (102 residues), 123.6 bits, E=1.9e-40

Best Hits

Swiss-Prot: 98% identical to RHAM_BACTN: L-rhamnose mutarotase (rhaM) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03534, L-rhamnose mutarotase [EC: 5.1.3.-] (inferred from 98% identity to bth:BT_4177)

MetaCyc: 48% identical to L-rhamnose mutarotase (Escherichia coli K-12 substr. MG1655)
RXN0-5306 [EC: 5.1.3.32]

Predicted SEED Role

"L-rhamnose mutarotase" in subsystem L-rhamnose utilization

MetaCyc Pathways

• L-rhamnose degradation I (5/5 steps found)
• superpathway of fucose and rhamnose degradation (10/12 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.- or 5.1.3.32

Protein Sequence (104 amino acids)

>BACOVA_04976 L-rhamnose 1-epimerase (Bacteroides ovatus ATCC 8483)
MKREAFKMYLKPGCEAEYEKRHAAIWPELKALLSKNGVSDYSIYWDKETNILFAFQKTEG
EAGSQDLGNTEIVQKWWDYMADIMEVNPDNSPVSIPLPEVFHMD