Protein Info for BACOVA_04940 in Bacteroides ovatus ATCC 8483

Annotation: putative molybdenum cofactor biosynthesis protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 664 PF13604: AAA_30" amino acids 16 to 161 (146 residues), 36.1 bits, see alignment E=3.4e-12 PF05970: PIF1" amino acids 17 to 201 (185 residues), 97.2 bits, see alignment E=6.5e-31 PF13245: AAA_19" amino acids 19 to 160 (142 residues), 42.4 bits, see alignment E=4.9e-14 PF13432: TPR_16" amino acids 542 to 596 (55 residues), 19.1 bits, see alignment 8.7e-07 amino acids 601 to 654 (54 residues), 16.9 bits, see alignment 4.3e-06 PF13431: TPR_17" amino acids 552 to 583 (32 residues), 25.1 bits, see alignment (E = 8.8e-09) PF13181: TPR_8" amino acids 598 to 630 (33 residues), 17.1 bits, see alignment (E = 2.9e-06)

Best Hits

KEGG orthology group: None (inferred from 96% identity to bth:BT_4130)

Predicted SEED Role

"putative helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (664 amino acids)

>BACOVA_04940 putative molybdenum cofactor biosynthesis protein C (Bacteroides ovatus ATCC 8483)
MSVDTNNAAFQDALNLIQYTRQSVFLTGKAGTGKSTFLRYVCENTKKKHVVLAPTGIAAI
NAGGSTMHSFFKLPFYPLLPDDPNLSLQRGRIHEFFKYTKPHRKLLEQIELVIIDEISMV
RADIIDAIDRILRVYSHNLREPFGGKQLLLVGDVFQLEPVVKNDEREILNRFYPTPYFFS
ARVFGQIDLVSIELQKVYRQTDPVFVGVLDHIRNNTAGAADLQLLNTRYGSQIEESEADM
YITLATRRDTVDSINEKKLAELPGDPITFEGVIEGDFPESSLPTSQELVLKPGAQIIFIK
NDFDRRWVNGTIGVIAGIDEEEETIYVITDDGKECDVKRESWRNIRYRYNEKTKEIEEEV
LGSFTQYPIRLAWAITVHKSQGLTFSRVVIDFTGGVFAGGQAYVALSRCTSLDGIQLKKP
INRADVFVRPEIVNFAGRFNDRQAIDKALKQAQADVQYAAASRAFDKGDMEECLEQFFRA
IHSRYDIEKSVPRRFIRRKLGVINTLKEQNKKLKEQMREQQERLRQYAHEYLLMGNECIT
QAHDSRAALANYDKALSLDPNYVDAWIRKGITLFNNKEYFDAENCFNTAVTLYPANFKAV
YNRGKLRLKTENTEGAIADLNKATSLKPEHAGAHELFGDALLKVGKEGEAALQWRIAEEL
RKKK