Protein Info for BACOVA_04896 in Bacteroides ovatus ATCC 8483

Annotation: transporter, major facilitator family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 348 to 365 (18 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details amino acids 403 to 422 (20 residues), see Phobius details amino acids 472 to 492 (21 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 421 (400 residues), 165.8 bits, see alignment E=1.4e-52 PF00083: Sugar_tr" amino acids 51 to 423 (373 residues), 35 bits, see alignment E=8.3e-13

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 96% identity to bth:BT_4105)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (505 amino acids)

>BACOVA_04896 transporter, major facilitator family protein (Bacteroides ovatus ATCC 8483)
MNAFQKTGEKMTNYRWTICAMLFFATTVNYLDRQVLSLTWDEFIKPEFHWDESHYGTITS
VFSIVYAICMLFAGRFVDWMGTKKGFLWAIGVWSAGACLHAVCGIVTEAQVGLHSAAELA
GATGDVVVTIATVSMYCFLAARCILALGEAGNFPAAIKVTAEYFPKKDRAYATSIFNAGA
SIGALIAPLTIPILAKMFGWEMAFIVIGGLGFIWMGFWVFMYDAPSKSKHVNQAELDYIE
QDNREAGSAPMTDEKDEKRMKFWQCFSYKQTWAFVFGKFMTDGVWWFFLFWTPSYLNTQF
GIKTSDPLGMALIFTLYAVTMLSIYGGKLPTIFINRTGMNPYAARMKAMLIFAFFPLVVL
LAQPLGTVSPWFPVILIGIGGAAHQSWSANIFSTVGDMFPRTAIASITGIGGMAGGVGSM
ILQKVAGNLFVYASGTTMIDGKEVEMTKELLEQGAQFVHPAMTFMGFEGKPAGYFVIFCV
CAVAYLLGWVIMKALVPKYKPIVLE