Protein Info for BACOVA_04861 in Bacteroides ovatus ATCC 8483

Annotation: NADH-quinone oxidoreductase, B subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01957: NADH-quinone oxidoreductase, B subunit
  • amino acids 37 to 178 (142 residues), 232.4 bits, E=8.3e-74
• PF01058: Oxidored_q6
  • amino acids 63 to 173 (111 residues), 106.4 bits, E=4.4e-35

Best Hits

Swiss-Prot: 95% identical to NUOB_BACTN: NADH-quinone oxidoreductase subunit B (nuoB) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 95% identity to bth:BT_4066)

MetaCyc: 39% identical to MbhJ (Pyrococcus furiosus)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• superpathway of hydrogen production (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• hydrogen production VI (1/2 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)
• Fe(II) oxidation (1/6 steps found)
• superpathway of photosynthetic hydrogen production (1/6 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism
• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2, 1.6.5.3

Use Curated BLAST to search for 1.12.7.2 or 1.6.5.3

Protein Sequence (200 amino acids)

>BACOVA_04861 NADH-quinone oxidoreductase, B subunit (Bacteroides ovatus ATCC 8483)
MEITKKPKIKSIPYDEFIDNESLEKLVKELNAGGANVALGVLDDFINWGRSNSLWPLTFA
TSCCGIEFMALGAARYDMARFGFEVARASPRQADMIMVCGTITNKMAPVLKRLYDQMPDP
KYVVAVGGCAVSGGPFKKSYHVVNGVDKILPVDVYIPGCPPRPEAFYYGMMQLQRKVKIE
KFFGGVNRKEKKPDYLKNEE