Protein Info for BACOVA_04858 in Bacteroides ovatus ATCC 8483

Annotation: 4Fe-4S binding domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13237: Fer4_10
  • amino acids 68 to 127 (60 residues), 26.4 bits, E=2.8e-09
• PF00037: Fer4
  • amino acids 69 to 89 (21 residues), 26.3 bits, see alignment (E = 2.4e-09)
  • amino acids 110 to 132 (23 residues), 30 bits, see alignment (E = 1.6e-10)
• PF12800: Fer4_4
  • amino acids 71 to 85 (15 residues), 16.2 bits, see alignment (E = 5.5e-06)
  • amino acids 115 to 127 (13 residues), 14 bits, see alignment (E = 2.8e-05)
• PF13187: Fer4_9
  • amino acids 72 to 131 (60 residues), 32.4 bits, E=3.9e-11
• PF12838: Fer4_7
  • amino acids 72 to 130 (59 residues), 42.8 bits, E=3.1e-14

Best Hits

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 94% identity to bth:BT_4063)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)
• Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (165 amino acids)

>BACOVA_04858 4Fe-4S binding domain protein (Bacteroides ovatus ATCC 8483)
MKIMEYKDKKYTYLGGLMHGISTLATGMKTSIKVYFRKKVTEQYPENRKELKMFDRFRGT
LNMPHNENNEHRCVACGLCQMACPNDTIKVTSETVETEDGKKKKILATYEYDLGACMFCQ
LCVNACPHDAITFDQNFEHAVFDRTKLVLKLNHDGSKVIEKKKEV