Protein Info for BACOVA_04856 in Bacteroides ovatus ATCC 8483

Annotation: putative NADH dehydrogenase subunit K

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00420: Oxidored_q2
  • amino acids 7 to 102 (96 residues), 83.9 bits, E=2.8e-28

Best Hits

Swiss-Prot: 47% identical to NUOK_GEOTN: NADH-quinone oxidoreductase subunit K (nuoK) from Geobacillus thermodenitrificans (strain NG80-2)

KEGG orthology group: K00340, NADH dehydrogenase I subunit K [EC: 1.6.5.3] (inferred from 97% identity to bth:BT_4061)

MetaCyc: 39% identical to ferredoxin-plastoquinone oxidoreductase subunit E (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)
• Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (102 amino acids)

>BACOVA_04856 putative NADH dehydrogenase subunit K (Bacteroides ovatus ATCC 8483)
MIHMEYYLVVSTIMMFAGIYGFFTRRNTLAILISVELMLNATDINFAVFNRFLFPEGMEG
YFFALFSIAISAAETAVAIAIMINIYRNLRSIQVRNLDELKW