Protein Info for BACOVA_04827 in Bacteroides ovatus ATCC 8483

Annotation: iojap-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 TIGR00090: ribosome silencing factor" amino acids 8 to 107 (100 residues), 104.4 bits, see alignment E=1.5e-34 PF02410: RsfS" amino acids 10 to 107 (98 residues), 109.6 bits, see alignment E=3.8e-36

Best Hits

KEGG orthology group: K09710, ribosome-associated protein (inferred from 92% identity to bth:BT_4008)

Predicted SEED Role

"Ribosomal silencing factor RsfA (former Iojap)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (119 amino acids)

>BACOVA_04827 iojap-like protein (Bacteroides ovatus ATCC 8483)
MNDTKVLIEKIKEGIQEKKGKKIIVADLTSIEDTICKYFVICQGNSPSQVSAIVDSIKEF
TRKGADSKPYAIDGLRNAEWVAMDYADVLVHVFLPETRDFYNLEHLWADAKLTQIPDLD