Protein Info for BACOVA_04810 in Bacteroides ovatus ATCC 8483

Annotation: putative alpha-1,2-mannosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 768 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01180: putative alpha-1,2-mannosidase" amino acids 25 to 753 (729 residues), 702 bits, see alignment E=4.2e-215 PF17678: Glyco_hydro_92N" amino acids 33 to 265 (233 residues), 272.4 bits, see alignment E=4.1e-85 PF07971: Glyco_hydro_92" amino acids 271 to 750 (480 residues), 601.1 bits, see alignment E=1.7e-184

Best Hits

KEGG orthology group: None (inferred from 90% identity to bth:BT_3991)

MetaCyc: 90% identical to alpha-1,3-mannosidase (Bacteroides thetaiotaomicron)
3.2.1.-; 3.2.1.-

Predicted SEED Role

"Alpha-1,2-mannosidase" in subsystem Mannose Metabolism

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (768 amino acids)

>BACOVA_04810 putative alpha-1,2-mannosidase (Bacteroides ovatus ATCC 8483)
MKLKTFLIVGCLGGLFTLSSCTAPTNVKDYSAYVNPFIGTGGHGHTFPGAVVPHGMIQPS
PDTRIDGWDACSGYYYADSTINGFSHTHVSGTGCCDYGDVLLMPTVGKQQYRTTDPQSQR
LAYASSFSHKNEIAEPGYYSVFLDTYQVKAEISSTKRGAIHRYTFPENTESGFIIDLDYS
LQRQTNSEMEIEVISDTEICGHKKTTYWAFDQYINFYAKFSKPFSYTLVTDSITMDNGKR
LPVCKALLHFNTSKDEQVLVKVGVSAVDIAGARKNVESEIPGWDFEKVRKDARTAWNEYL
SKIDITTSDKEDKAIFYTALYHTGISPNLFTDADGRYLGMDLEVHQGDTLNPIYTVFSLW
DTFRALHPLMTIIDPDLNNHFINSLIKKHQEGGIYPMWDLASNYTGTMIGYHAVPVIVDA
YMKGYRNFDTKEAYKACLRAAEYDTTGIKCPDLVLPHLMPKAKYYKNAIGYIPCDRENES
VAKALEYAYDDWCISIFAEAMSDFESKAKYERFAKAYEFYFDKSIRFMRGLDSKGEWRTP
FNPRASTHRSDDYCEGTAWQWTWFVPHDVEGLVNLMGGEDAFVQKLDSLFSADSSLEGET
TSSDISGLIGQYAHGNEPSHHVIHLYNYVNHPWRTQELVDSVYRSQYANSIEGLSGNEDC
GQMSAWYILNSMGFYQVCPGKPVYSIGRPAFDKAVINLPEGKTFSIVVKNNGKKNKYIES
VLLNGKALNIPFFNHQDIANGGTMEIKMTDHPTKWGVLSPALSSKEEE