Protein Info for BACOVA_04583 in Bacteroides ovatus ATCC 8483

Annotation: hydrogenase maturation GTPase HydF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 TIGR03918: [FeFe] hydrogenase H-cluster maturation GTPase HydF" amino acids 6 to 394 (389 residues), 556 bits, see alignment E=4.3e-171 TIGR00231: small GTP-binding protein domain" amino acids 12 to 166 (155 residues), 75.9 bits, see alignment E=3.1e-25 PF01926: MMR_HSR1" amino acids 13 to 126 (114 residues), 84.4 bits, see alignment E=1.9e-27 PF02421: FeoB_N" amino acids 13 to 166 (154 residues), 47.2 bits, see alignment E=5.3e-16 PF18128: HydF_dimer" amino acids 179 to 277 (99 residues), 126.7 bits, see alignment E=9.9e-41 PF18133: HydF_tetramer" amino acids 281 to 393 (113 residues), 141.3 bits, see alignment E=3.8e-45

Best Hits

KEGG orthology group: None (inferred from 80% identity to bth:BT_1837)

Predicted SEED Role

"[FeFe]-hydrogenase maturation GTPase HydF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>BACOVA_04583 hydrogenase maturation GTPase HydF (Bacteroides ovatus ATCC 8483)
MSLTDTPNASRLHIALFGRRNSGKSSLINALTGQDTALVSDTPGTTTDLVSKAMEIQGIG
PCLFIDTPGFDDEGELGELRISRTLKAIEKTDIALLLCGDTTFSHEKEMLTLLKEKNIPV
IPVLNKIDIRENSDSLATYIEEEYKIRPLLISAKEKTGIEQIRQAILEKLPSDFGQQSIT
GELVTENDLVLLVMPQDIQAPKGRLILPQVQTIRELLDKKCLVVTCTTDKFPATLQALAR
LPKLIITDSQVFKTIYEQKPEESELTSFSVLFAGYKGDIHYYVESATAIERLTESSRVLI
AEACTHAPLSEDIGRVKLPRLLRKRIGENLQIDMVAGTDFPQDLTPYSLVIHCGACMFNR
KYVLSRIERAREQHIPMTNYGVAIAFLNGILDQIKY