Protein Info for BACOVA_04543 in Bacteroides ovatus ATCC 8483

Annotation: GAF domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF01590: GAF" amino acids 32 to 154 (123 residues), 51.4 bits, see alignment E=1.7e-17 PF13185: GAF_2" amino acids 37 to 155 (119 residues), 53 bits, see alignment E=4.6e-18

Best Hits

Swiss-Prot: 70% identical to GAFA_DICDI: GAF domain-containing protein A (gafA) from Dictyostelium discoideum

KEGG orthology group: K07170, GAF domain-containing protein (inferred from 86% identity to bth:BT_1810)

Predicted SEED Role

"GAF domain-containing protein, involved in signal transduction"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>BACOVA_04543 GAF domain protein (Bacteroides ovatus ATCC 8483)
MAENLIIHTGSKEEKYRELLPQLHALVSTEADLIANLANMVAALKQTFGFFWVGFYLVKE
EELVLGPFQGPIACTRIRFGRGVCGTAWKEARTLIVPDVEQFPGHIACSSDSKSEIVVPI
LKQGKVVGVLDIDSDTLDSFDTIDARYLEEICTYIVL