Protein Info for BACOVA_04516 in Bacteroides ovatus ATCC 8483

Annotation: peptidase C1-like family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00112: Peptidase_C1" amino acids 35 to 79 (45 residues), 21.5 bits, see alignment 2.3e-08 PF03051: Peptidase_C1_2" amino acids 81 to 270 (190 residues), 38.1 bits, see alignment E=9e-14 amino acids 324 to 390 (67 residues), 29.9 bits, see alignment E=2.7e-11

Best Hits

KEGG orthology group: None (inferred from 91% identity to bth:BT_1789)

Predicted SEED Role

"Aminopeptidase C (EC 3.4.22.40)" in subsystem Protein degradation (EC 3.4.22.40)

Isozymes

Compare fitness of predicted isozymes for: 3.4.22.40

Use Curated BLAST to search for 3.4.22.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>BACOVA_04516 peptidase C1-like family (Bacteroides ovatus ATCC 8483)
MKKTILIAALGLFSLSVMAQDAKPEEGFVFTTVKENPITSIKNQNRSSTCWSFSTLGFVE
SELLRLGKGEYDLSEMFVVHKTMQDRGVNYVRYHGDSSFSPGGSFYDVMYCIKNYGIVPQ
EVMPGIMYGDTLPVHNELDAVASGYINAIAKGKLSKLTPVWKNGLSAIYDTYLGACPEKF
TYKGKEYTPKTFAESLGLNYNDYVSLTSYTHHPFYSQFAIEIQDNWRNGLSYNLPIEELM
AVMDNAVKKGYTFAWGSDVSEQGFSRDGIAVMPDAAKESELSGSDMARWTGLTAADKRRE
LFTKPFPEKDITQEMRQVAFDNWETTDDHGMVIYGIAKDQNGKEYFMVKNSWGKSGKYDG
IWYASKAFVAYKTMNILVHKDALPKEIAKKLGIK