Protein Info for BACOVA_04467 in Bacteroides ovatus ATCC 8483

Annotation: chromate transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 165 to 181 (17 residues), see Phobius details PF02417: Chromate_transp" amino acids 4 to 179 (176 residues), 187.3 bits, see alignment E=1.2e-59

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 96% identity to bth:BT_1736)

Predicted SEED Role

"Chromate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>BACOVA_04467 chromate transport protein (Bacteroides ovatus ATCC 8483)
MIYLQLFYTFFKIGLFGFGGGYAMLSMIQGEVVTRYGWVSSQEFTDIVAISQMTPGPIGI
NAATYVGFTSTGSVWGSIIATFAVVLPSFILMLTISKFFLKYQKHPIVESIFNGLRPAVV
GLLASAALVLMNAENFGSPTEDTYSFVISIIIFLIAFIGTRKYKANPILMIIACGIAGLL
LY