Protein Info for BACOVA_04373 in Bacteroides ovatus ATCC 8483

Annotation: deoxyribose-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF01791: DeoC" amino acids 69 to 326 (258 residues), 203.2 bits, see alignment E=2.3e-64

Best Hits

Swiss-Prot: 65% identical to ALF1_ECOL6: Fructose-bisphosphate aldolase class 1 (fbaB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01623, fructose-bisphosphate aldolase, class I [EC: 4.1.2.13] (inferred from 93% identity to bth:BT_1659)

MetaCyc: 65% identical to fructose-bisphosphate aldolase class I (Escherichia coli K-12 substr. MG1655)
Fructose-bisphosphate aldolase. [EC: 4.1.2.13]

Predicted SEED Role

"Fructose-bisphosphate aldolase class I (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13

Use Curated BLAST to search for 4.1.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>BACOVA_04373 deoxyribose-phosphate aldolase (Bacteroides ovatus ATCC 8483)
MSKVVELLRDKACYYLDHTCETIDKSLIHVPSPDTIDKIWIDSDRSIRVLNSLQTLLGHG
RLANTGYVSILPVDQDIEHTAGASFAPNPIYFDPENIVKLAIEGGCNGVASTFGILGSVA
RKYAHKIPFIVKLNHNELLSYPNSFDQVLFGTVKEAWNMGAVAVGATIYFGSEQSRRQLV
EIAEAFEYAHELGMATILWCYLRNNDFKKGAVDYHAAADLTGQADRLGVTIKADIVKQKL
PTNNGGFKAIGFGKIDERMYTELASEHPIDLCRYQVANGYMGRVGLINSGGESHGSSDLR
DAVITAVVNKRAGGMGLISGRKAFQKPMNEGVELLNTIQDVYLDSSITIA