Protein Info for BACOVA_04309 in Bacteroides ovatus ATCC 8483

Annotation: protein ExsB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 TIGR00364: queuosine biosynthesis protein QueC" amino acids 6 to 206 (201 residues), 260.8 bits, see alignment E=3.8e-82 PF06508: QueC" amino acids 6 to 213 (208 residues), 285 bits, see alignment E=3.2e-89

Best Hits

Swiss-Prot: 97% identical to QUEC_BACTN: 7-cyano-7-deazaguanine synthase (queC) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 97% identity to bth:BT_1566)

MetaCyc: 56% identical to 7-cyano-7-deazaguanine synthase (Bacillus subtilis subtilis 168)
RXN-12093 [EC: 6.3.4.20]

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>BACOVA_04309 protein ExsB (Bacteroides ovatus ATCC 8483)
MNREAALVVFSGGQDSTTCLFWAKRNFKKVYALSFLYGQKHQKEVELAREIARKAEVEFD
VMDVSFIGQLGHNSLTDTTMVMDQEKPADSVPNTFVPGRNLFFLSIAAVYARERGINHLV
TGVSQTDFSGYPDCRDAFIKSLNVTLNLAMDEQFVIHTPLMWIDKAETWALADELGVLEL
IRTETLTCYNGVQGDGCGHCPACTLRREGLEKYLKSKNQ