Protein Info for BACOVA_04254 in Bacteroides ovatus ATCC 8483

Annotation: alcohol dehydrogenase, iron-dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF00465: Fe-ADH" amino acids 9 to 381 (373 residues), 330.2 bits, see alignment E=1.4e-102 PF13685: Fe-ADH_2" amino acids 14 to 110 (97 residues), 37.5 bits, see alignment E=2.3e-13

Best Hits

Swiss-Prot: 43% identical to ADH2_GEOTN: Long-chain-alcohol dehydrogenase 2 (adh2) from Geobacillus thermodenitrificans (strain NG80-2)

KEGG orthology group: None (inferred from 78% identity to bhl:Bache_2975)

MetaCyc: 38% identical to BdhA (Clostridium acetobutylicum)
1.1.1.-

Predicted SEED Role

"NADH-dependent butanol dehydrogenase A (EC 1.1.1.-)" in subsystem Butanol Biosynthesis (EC 1.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>BACOVA_04254 alcohol dehydrogenase, iron-dependent (Bacteroides ovatus ATCC 8483)
MNNFIFYSPTEFVFGRDTEAQTGALVQKYGARKVMIVYGGGSVIRSGLLARVEKSLQEVG
IPYCMLGGVQPNPIDTKVYEGIDLCRKESVDMMLAVGGGSVIDTAKAIAAGVPYDGDFWD
FYIGKAVVAEALKVAVVLTIPAAGSEGSGNTVITKVDGLQKLSLRAPSVLRPVFAVMNPE
LTYTLPPFQTACGVADMMAHIMERYFTNTKEVEIGDRLCEGTLLAIIKEATTVMKDPENY
GARANLMWCGTIAHNGTCGVGCEEDWASHFLEHEISAIYNVTHGAGLSVIFPAWMTWMTE
HNVDKIAQYAIRVWGVADSADKKAVALEGISRLKTFFTSIGLPVTFKELGIENPDIDRLA
DSLHRNKGELVGNYVKLTKKDSKEIYRLAL