Protein Info for BACOVA_04187 in Bacteroides ovatus ATCC 8483

Annotation: transporter, major facilitator family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 314 to 331 (18 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 383 to 401 (19 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 365 (349 residues), 157.2 bits, see alignment E=2.8e-50 amino acids 242 to 402 (161 residues), 41.9 bits, see alignment E=3.1e-15

Best Hits

KEGG orthology group: None (inferred from 67% identity to bfs:BF1714)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>BACOVA_04187 transporter, major facilitator family protein (Bacteroides ovatus ATCC 8483)
MNNKTSNIYPWVVVGLLWGVALLNYMDRQMLSTMRIPMMEDVRELESAANFGRLMAVFLW
VYGLMSPLSGIVGDRMSRKWLIVGSLCVWSGVTYLMGYATTFNQLYWLRGIMGISEALYL
PAALSLIADFHKDKTRSLAVGIHMTGLYVGQAIGGFGATFAAIYSWHTTFHWFGIIGVGY
GVILAFLLRDKERGSVSENQKMKKIPVLKSLGMLFSNVFFWIILFYFCVPGTPGWAAKNW
LPTLFSDSLSIDISVAGPMSTISIALSSLFGVLAGGYISDRWVLKNVRGRVYTGAMGLGL
IIPSLLFIGYGHSIFALVMGAMLFGIGFGMFDANNMPILCQFVSARYRATAYGIMNMCGV
FAGAIITSLLGESMDAGHLGRDFALLAILVFVMLVILVTCLRPKTIDMKD