Protein Info for BACOVA_04057 in Bacteroides ovatus ATCC 8483

Annotation: recombination protein RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR00615: recombination protein RecR" amino acids 46 to 234 (189 residues), 235.7 bits, see alignment E=1.6e-74 PF21176: RecR_HhH" amino acids 47 to 87 (41 residues), 42.2 bits, see alignment 1.2e-14 PF02132: RecR_ZnF" amino acids 93 to 113 (21 residues), 36.2 bits, see alignment (E = 7.6e-13) PF13662: Toprim_4" amino acids 119 to 210 (92 residues), 90.2 bits, see alignment E=1.7e-29 PF01751: Toprim" amino acids 120 to 201 (82 residues), 27.4 bits, see alignment E=6.2e-10

Best Hits

Swiss-Prot: 97% identical to RECR_BACTN: Recombination protein RecR (recR) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K06187, recombination protein RecR (inferred from 97% identity to bth:BT_1081)

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>BACOVA_04057 recombination protein RecR (Bacteroides ovatus ATCC 8483)
MTSIIITDAKVAIFVGIKNNNLYLCRVLSIEQQILSMNQQYPSILLEKAVGEFSKLPGIG
RKTAMRLVLHLLRQDTATVEAFGNSIITLKREVKYCKVCHNISDTETCQICANPQRDAST
VCVVENIRDVMAVEATQQYRGLYHVLGGVISPMDGVGPSDLQIESLVQRVAEGGIKEVIL
ALSTTMEGDTTNFYIYRKLDKLGVKLSVIARGISIGDELEYADEVTLGRSIVNRTLFTGT
V