Protein Info for BACOVA_04029 in Bacteroides ovatus ATCC 8483

Annotation: phosphoserine transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 96% identical to SERC_BACTN: Phosphoserine aminotransferase (serC) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00831, phosphoserine aminotransferase [EC: 2.6.1.52] (inferred from 96% identity to bth:BT_1153)

Predicted SEED Role

"Phosphoserine aminotransferase (EC 2.6.1.52)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 2.6.1.52)

MetaCyc Pathways

superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
L-serine biosynthesis I (3/3 steps found)
superpathway of sulfate assimilation and cysteine biosynthesis (7/9 steps found)
L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>BACOVA_04029 phosphoserine transaminase (Bacteroides ovatus ATCC 8483)
MKKHNFNAGPSILPREVIEDTAKAILDFNGSGLSLMEISHRAKDFQPVVDEAEALFKELL
NIPEGYSVLFLGGGASMEFCMVPYNFLEKKAAYLNTGVWAKKAMKEAKGFGEVVEVASSA
EATYTYIPKDYTIPTDADYFHITTNNTIYGTELKKDLDSPVPMVADMSSDIFSRPIDVSK
YICIYGGAQKNLAPAGVTFVIVKNDALGKVSRYIPTMLNYQTHVDSGSMFNTPPVVPIYA
ALQTLRWIKAQGGVKEMERRAIEKADMLYAEIDRNKMFVGTAAKEDRSRMNICFVMAPEY
KDFEADFLKFATERGMVGIKGHRSVGGFRASCYNALPKESVQALIDCMQEFEKLH