Protein Info for BACOVA_03997 in Bacteroides ovatus ATCC 8483

Annotation: glycosyltransferase, SP_1767 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 226 to 243 (18 residues), see Phobius details TIGR03728: glycosyltransferase, SP_1767 family" amino acids 40 to 302 (263 residues), 353.9 bits, see alignment E=2.8e-110 PF08759: GT-D" amino acids 57 to 280 (224 residues), 313.5 bits, see alignment E=4.6e-98

Best Hits

KEGG orthology group: None (inferred from 77% identity to bth:BT_1179)

Predicted SEED Role

"Glycosyltransferase, family 8"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>BACOVA_03997 glycosyltransferase, SP_1767 family (Bacteroides ovatus ATCC 8483)
MNIRDIFITLRYKISYGSTVEWYNFWYIVLRKKRKITPQVASIDETIRKIIDDRCSVSRF
GDGEVLLTSPEKEIRFQKGDPLLAKRLTEVLQSHEEGHIVCISDAFRDLYRYNRKSRRFW
RTHFYLYGSWWDRLLVAGRKYYNTFVTRPYMDFARKEDSARWFHDMKGIWDNRDIVFIEG
EKSRLGVGNDLFDNARSIRRILCPPRDAFERLEDIKREACKVEKEALLLIALGPAATVLA
YDLFKAGYQAIDVGHVDVEYEWWRMGAHKKVKLERKYVNETAIGSEVADAGEEYRKQIIA
QIV