Protein Info for BACOVA_03979 in Bacteroides ovatus ATCC 8483

Annotation: Sigma-70 region 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 13 to 163 (151 residues), 82.1 bits, see alignment E=1.7e-27 PF04542: Sigma70_r2" amino acids 15 to 73 (59 residues), 51.1 bits, see alignment E=1.4e-17 PF07638: Sigma70_ECF" amino acids 27 to 165 (139 residues), 23.7 bits, see alignment E=6e-09 PF08281: Sigma70_r4_2" amino acids 108 to 159 (52 residues), 50.4 bits, see alignment E=2e-17

Best Hits

Swiss-Prot: 33% identical to ECFG_RHOPT: ECF RNA polymerase sigma factor EcfG (ecfG) from Rhodopseudomonas palustris (strain TIE-1)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 97% identity to bth:BT_1197)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (167 amino acids)

>BACOVA_03979 Sigma-70 region 2 (Bacteroides ovatus ATCC 8483)
MKSLSFRKDLIGVQEELLRFAYKLTANREEANDLLQETSLKALDNEEKYVPDTNFKGWMY
TIMRNIFINNYRKIVRDQTFVDTTDNYYHLNLPQDSGFESTEGAYDLKEMHRIVNALPRE
YKIPFSMHVSGFKYREIAEKLGLPLGTVKSRIFFTRQRLQQELKDFV