Protein Info for BACOVA_03818 in Bacteroides ovatus ATCC 8483

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 50 to 67 (18 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 18 to 289 (272 residues), 253.1 bits, see alignment E=1.7e-79 PF01545: Cation_efflux" amino acids 21 to 208 (188 residues), 134.2 bits, see alignment E=2.6e-43

Best Hits

Swiss-Prot: 35% identical to CZCD_BACSU: Cadmium, cobalt and zinc/H(+)-K(+) antiporter (czcD) from Bacillus subtilis (strain 168)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 91% identity to bth:BT_0499)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>BACOVA_03818 cation diffusion facilitator family transporter (Bacteroides ovatus ATCC 8483)
MEPHHHHEHSHRLTSLNKAFIIGIALNITFVIVEFGVGFYYNSLGLLSDAGHNLGDVASL
VLAMLAFRLEKVHPNSRYTYGYKKSTILVSLLNAVILLIAVGIIIAESIDKLFHPVSVDG
SAIAWTAGVGVVINALTAWLFMKDKDKDLNVKGAYLHMAADTLVSVGVVASGIIITYTGW
SIIDPIIGLGIAVIIIVSTWGLLHDSLRLSLDGVPVGIDAQKIQQLIVEQPGVENCHHLH
IWALSTTETALTAHVVIDNITQLEEVKHHIKEALEEAGIHHATLEFEDERATCSNECCED