Protein Info for BACOVA_03793 in Bacteroides ovatus ATCC 8483

Annotation: bacterial transferase hexapeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF14602: Hexapep_2" amino acids 87 to 120 (34 residues), 13.3 bits, see alignment 5.8e-06 amino acids 142 to 176 (35 residues), 44.5 bits, see alignment 1e-15 PF00132: Hexapep" amino acids 143 to 176 (34 residues), 43 bits, see alignment 2.4e-15

Best Hits

KEGG orthology group: K00633, galactoside O-acetyltransferase [EC: 2.3.1.18] (inferred from 89% identity to bth:BT_0521)

Predicted SEED Role

"Galactoside O-acetyltransferase (EC 2.3.1.18)" in subsystem Lactose utilization (EC 2.3.1.18)

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.18

Use Curated BLAST to search for 2.3.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>BACOVA_03793 bacterial transferase hexapeptide repeat protein (Bacteroides ovatus ATCC 8483)
MEKKTLKQRIKENPGLKQAVHRFIMHPVKTRPNWWIRLFDFIYLKRGKGSVIYRSVRKDL
PPFNRFSLGKYSVVEDFSCLNNAVGDLTIGDYTRIGLRNTIIGPINIGNHVNLAQNVTVT
GLNHNYQDAEKMIDEQGVSTLPVVIEDDVWVGANSVILPGVTLGKHCVVAAGSVVSHSVP
PYSICAGCPARIIKTYDFETKEWKKVEKTPATNHK