Protein Info for BACOVA_03790 in Bacteroides ovatus ATCC 8483

Annotation: response regulator receiver domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 PF00072: Response_reg" amino acids 5 to 116 (112 residues), 76.1 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 35% identical to ORR5_ORYSJ: Two-component response regulator ORR5 (RR5) from Oryza sativa subsp. japonica

KEGG orthology group: None (inferred from 91% identity to bth:BT_0524)

Predicted SEED Role

"putative two-component system response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>BACOVA_03790 response regulator receiver domain protein (Bacteroides ovatus ATCC 8483)
MKKKILLVDDKSTIGKVAGVYLGKEYDFTYLEDPIKAIEWLNEGNVPDLIISDIRMPLMM
GDEFLRYMKNNELFKSIPIVMLSSEESTTERIRLLEEGAEDYILKPFNPLELKIRIKKII
D