Protein Info for BACOVA_03678 in Bacteroides ovatus ATCC 8483

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 66 (26 residues), see Phobius details amino acids 79 to 103 (25 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 286 to 311 (26 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 359 to 393 (35 residues), see Phobius details amino acids 416 to 437 (22 residues), see Phobius details amino acids 445 to 467 (23 residues), see Phobius details PF01943: Polysacc_synt" amino acids 9 to 275 (267 residues), 108.5 bits, see alignment E=6.2e-35 PF13440: Polysacc_synt_3" amino acids 30 to 322 (293 residues), 238 bits, see alignment E=2e-74

Best Hits

KEGG orthology group: None (inferred from 33% identity to sun:SUN_1547)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>BACOVA_03678 polysaccharide biosynthesis protein (Bacteroides ovatus ATCC 8483)
MSKSAVISGAKWMTISTIVSSIVGILRLSILARFLDKSDFGIVAVLTLILGLTSMFSDMG
FATVIMHKQNLDRRQFSSLFWIQMAVYFILYIIIICFTHPISLFYKEPILHYLIPLSLLD
LLFIGIGKLYETVLQKNFQFKILAIRNIISCILSLVLAVIMAIMGCGVYTLVLSTLFATA
FLSVWNFVLGQKHIRLQFYCSVKEILPLIKIGLYQTGTQIVDYLCTKLDVLIIGKLLGME
VLGLYNLSKEFVFRLIQIINTIVNRVLTPAFAKIQHEKARMSKTYCYVLQSLTSLTFPIL
TIISILSVQIIEVLYGSNYKEAGLLTAILSLAAVGTAVGNPVRNIIVATGRTDLTFKYVW
VRSIFTIPCVYVCSLYSIEMVAWGQVLLSIIDYYLQWKMEIKPSIGLSFLDLTKSFLKQG
CISLLLGFVGFIIFSTNPLLFDTVIIQAVVYGVIACFVYFASIYIFMNSELINFLGLIKR
IIRN