Protein Info for BACOVA_03551 in Bacteroides ovatus ATCC 8483

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00838: argininosuccinate lyase
  • amino acids 31 to 398 (368 residues), 340.3 bits, E=1.1e-105
• PF00206: Lyase_1
  • amino acids 34 to 307 (274 residues), 169 bits, E=8.7e-54

Best Hits

Swiss-Prot: 95% identical to ARLY_BACTN: Argininosuccinate lyase (argH) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 95% identity to bth:BT_3733)

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (9/9 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (8/10 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• urea cycle (3/5 steps found)
• canavanine biosynthesis (2/4 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• superpathway of arginine and polyamine biosynthesis (10/17 steps found)
• L-arginine biosynthesis IV (archaea) (3/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Protein Sequence (453 amino acids)

>BACOVA_03551 argininosuccinate lyase (Bacteroides ovatus ATCC 8483)
MDIKLFFMAQKLWEKSVQVNKDIERFTVGRDREMDLYLAKHDVLGSMAHITMLESIGLLT
KEELDQLLVELKSIYASAEKGEFVIEDGVEDVHSQVELMLTRRLGDIGKKIHSGRSRNDQ
VLLDLKLFTRTQIKEVAEAVEQLFHVLIRQSERYKNVLMPGYTHLQIAMPSSFGLWFGAY
AESLMDDMLFLQAAFKMCNRNPLGSAAGYGSSFPLNRTMTTDLLGFDSMNYNVVYAQMGR
GKMERNVAFALATIAGTISKLAFDACMFNSQNFGFVKLPDDCTTGSSIMPHKKNPDVFEL
TRAKCNKLQSLPQQIMMIANNLPSGYFRDLQIIKEVFLPAFQELKDCLQMTTYIMNEIKV
NEHILDDDKYLLIFSVEEVNRLAREGMPFRDAYKKVGLDIEAGKFSHTKEVHHTHEGSIG
NLCNAEISALMQQVIDGFNFCGMEKAEKALLGR