Protein Info for BACOVA_03547 in Bacteroides ovatus ATCC 8483

Annotation: protein-(glutamine-N5) methyltransferase, release factor-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR00536: methyltransferase, HemK family" amino acids 5 to 276 (272 residues), 178.4 bits, see alignment E=1.6e-56 PF17827: PrmC_N" amino acids 7 to 74 (68 residues), 35.7 bits, see alignment E=4.1e-12 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 27 to 274 (248 residues), 235.1 bits, see alignment E=8.8e-74 PF05175: MTS" amino acids 99 to 194 (96 residues), 59.5 bits, see alignment E=1.3e-19 PF06325: PrmA" amino acids 107 to 184 (78 residues), 27.8 bits, see alignment E=7.2e-10 PF13847: Methyltransf_31" amino acids 112 to 185 (74 residues), 37.2 bits, see alignment E=1e-12 PF13649: Methyltransf_25" amino acids 114 to 189 (76 residues), 43 bits, see alignment E=2.5e-14 PF08242: Methyltransf_12" amino acids 114 to 184 (71 residues), 32.7 bits, see alignment E=4.2e-11 PF08241: Methyltransf_11" amino acids 114 to 184 (71 residues), 26.9 bits, see alignment E=2.4e-09 PF01170: UPF0020" amino acids 133 to 195 (63 residues), 22.5 bits, see alignment E=3.4e-08

Best Hits

Swiss-Prot: 83% identical to PRMC_BACTN: Release factor glutamine methyltransferase (prmC) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 83% identity to bth:BT_3729)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>BACOVA_03547 protein-(glutamine-N5) methyltransferase, release factor-specific (Bacteroides ovatus ATCC 8483)
MNRITAYIRQSLQESYPQEEIKALSMLICCDMLGLDALDIYMGKDIILSECKQRELENII
FRLQKNEPIQYIRGFAEFSGRNFKVASGVLIPRPETAELVELIVKENPNARHLLDIGTGS
GCIAISLDKKLPDVDVEAWDISEEALAIARKNNEDLEAGVRFLQRDVLSDDWEKVPSFDV
IVSNPPYVTETEKNEMDANVLDWEPGLALFVPDEDPLRFYNRIACLGSELLLPGGKLYFE
INQAYGRETAHILEMNQYRDVRVIKDIFGKDRIVTANR